CTLA4 (Human) Recombinant Protein
  • CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein

Ref: AB-P8529
25 ug

Información del producto

CTLA4 (Human) Recombinant Protein
Información adicional
Size 25 ug
Gene Name CTLA4
Gene Alias CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD.
Form Liquid
Antigen species Target species Human
Storage Buffer The CTLA 4 solution (1mg/1ml) contains 20mM Tris-HCl buffer (pH 8.0), 0.4M urea and 10% glycerol.
Gene ID 1493

Enviar un mensaje


CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein