View larger
Human CTLA4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi
AB-P8529
New product
CTLA4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | CTLA4 |
| Gene Alias | CD152|CELIAC3|CTLA-4|GSE|IDDM12 |
| Gene Description | cytotoxic T-lymphocyte-associated protein 4 |
| Storage Conditions | Store at 4ºC if entire vial will be used within 2-4 weeks. Store, frozen at -20ºC for longer periods of time. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | The CTLA 4 solution (1mg/1ml) contains 20mM Tris-HCl buffer (pH 8.0), 0.4M urea and 10% glycerol. |
| Gene ID | 1493 |
More info
Human CTLA4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.