Ctf2 (Mouse) Recombinant Protein Ver mas grande

Ctf2 (Mouse) Recombinant Protein

AB-P8522

Producto nuevo

Ctf2 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 12 Biopuntos. Su cesta contiene un total 12 Biopuntos puede ser convertido en un Biobonos Descuento 48.00EUR.


Hoja técnica

Size 100 ug
Gene Name Ctf2
Gene Alias Gm494|NP
Gene Description cardiotrophin 2
Storage Conditions Lyophilized CTF2P although stable at room temperature for 3 weeks, should be stored desiccated below -18ºC. Upon reconstitution Neuropoietin should be stored at 4ºC between 2-7 days and for future use below -18ºC.
Immunogen Prot. Seq APISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a 0.2 um filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 0.5mM DTT and 500mM NaCl.
Gene ID 244218

Más información

Mouse Ctf2 (P83714) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Ctf2 (Mouse) Recombinant Protein

Ctf2 (Mouse) Recombinant Protein