Ctf2 (Mouse) Recombinant Protein
  • Ctf2 (Mouse) Recombinant Protein

Ctf2 (Mouse) Recombinant Protein

Ref: AB-P8522
Ctf2 (Mouse) Recombinant Protein

Información del producto

Mouse Ctf2 (P83714) recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Ctf2
Gene Alias Gm494|NP
Gene Description cardiotrophin 2
Storage Conditions Lyophilized CTF2P although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Neuropoietin should be stored at 4C between 2-7 days and for future use below -18C.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a 0.2 um filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 0.5mM DTT and 500mM NaCl.
Gene ID 244218

Enviar uma mensagem


Ctf2 (Mouse) Recombinant Protein

Ctf2 (Mouse) Recombinant Protein