Clcf1 (Rat) Recombinant Protein
  • Clcf1 (Rat) Recombinant Protein

Clcf1 (Rat) Recombinant Protein

Ref: AB-P8511
Clcf1 (Rat) Recombinant Protein

Información del producto

Rat Clcf1 (P20294, 1 a.a. - 200 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Clcf1
Gene Alias Bsf3|Clc|MGC112574|NNT-1
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMAFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Form Liquid
Antigen species Target species Rat
Storage Buffer CNTF protein solution (0.5mg/mL) containing phosphate buffered saline (pH 7.4) and 10% glycerol.
Gene ID 365395

Enviar un mensaje


Clcf1 (Rat) Recombinant Protein

Clcf1 (Rat) Recombinant Protein