View larger
Rat Clcf1 (P20294, 1 a.a. - 200 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichia c
AB-P8511
New product
Clcf1 (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Clcf1 |
| Gene Alias | Bsf3|Clc|MGC112574|NNT-1 |
| Gene Description | cardiotrophin-like cytokine factor 1 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMAFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM. |
| Form | Liquid |
| Antigen species Target species | Rat |
| Storage Buffer | CNTF protein solution (0.5mg/mL) containing phosphate buffered saline (pH 7.4) and 10% glycerol. |
| Gene ID | 365395 |
More info
Rat Clcf1 (P20294, 1 a.a. - 200 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.