Ver mas grande
CLCF1 (Human) Recombinant Protein
AB-P8507
Producto nuevo
CLCF1 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CLCF1 |
| Gene Alias | BSF3|CISS2|CLC|NNT1|NR6 |
| Gene Description | cardiotrophin-like cytokine factor 1 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | CNTF protein solution (1mg/mL) contains 20mM Tris-HCl buffer pH-8 and 1mM DTT. |
| Gene ID | 23529 |
Más información
Human CLCF1 (Q9UBD9, 1 a.a. - 200 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.