CLCF1 (Human) Recombinant Protein
  • CLCF1 (Human) Recombinant Protein

CLCF1 (Human) Recombinant Protein

Ref: AB-P8507
20 ug

Información del producto

CLCF1 (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name CLCF1
Gene Alias BSF3|CISS2|CLC|NNT1|NR6
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM.
Form Liquid
Antigen species Target species Human
Storage Buffer CNTF protein solution (1mg/mL) contains 20mM Tris-HCl buffer pH-8 and 1mM DTT.
Gene ID 23529

Enviar uma mensagem


CLCF1 (Human) Recombinant Protein

CLCF1 (Human) Recombinant Protein