BTC (Human) Recombinant Protein
  • BTC (Human) Recombinant Protein

BTC (Human) Recombinant Protein

Ref: AB-P8499
2 x 10 ug

Información del producto

BTC (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name BTC
Gene Alias -
Gene Description betacellulin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYHHHHHH.
Form Liquid
Antigen species Target species Human
Storage Buffer BTC protein (0.25mg/mL) contains 10% glycerol and Phosphate-Buffered Saline (pH 7.4).
Gene ID 685

Enviar un mensaje


BTC (Human) Recombinant Protein

BTC (Human) Recombinant Protein