View larger
Human BTC (P35070, 32 a.a. - 111 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.
AB-P8499
New product
BTC (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | BTC |
| Gene Alias | - |
| Gene Description | betacellulin |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | BTC protein (0.25mg/mL) contains 10% glycerol and Phosphate-Buffered Saline (pH 7.4). |
| Gene ID | 685 |
More info
Human BTC (P35070, 32 a.a. - 111 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.