Ver mas grande
BTC (Human) Recombinant Protein
AB-P8497
Producto nuevo
BTC (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | BTC |
| Gene Alias | - |
| Gene Description | betacellulin |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | The Betacellulin Human Recombinant was lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4. |
| Gene ID | 685 |
Más información
Human BTC (P35070) recombinant protein expressed in Escherichia coli.