BTC (Human) Recombinant Protein
  • BTC (Human) Recombinant Protein

BTC (Human) Recombinant Protein

Ref: AB-P8497
20 ug

Información del producto

BTC (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name BTC
Gene Alias -
Gene Description betacellulin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY.
Form Lyophilized
Antigen species Target species Human
Storage Buffer The Betacellulin Human Recombinant was lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Gene ID 685

Enviar uma mensagem


BTC (Human) Recombinant Protein

BTC (Human) Recombinant Protein