BST2 (Human) Recombinant Protein
  • BST2 (Human) Recombinant Protein

BST2 (Human) Recombinant Protein

Ref: AB-P8496
2 x 10 ug

Información del producto

BST2 (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name BST2
Gene Alias CD317
Gene Description bone marrow stromal cell antigen 2
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS.
Form Liquid
Antigen species Target species Human
Storage Buffer BST2 protein 0.5mg/mL is supplied in 20mM Tris-HCl, pH-8, 0.1M NaCl, 1mM DTT and 20% Glycerol.
Gene ID 684

Enviar un mensaje


BST2 (Human) Recombinant Protein

BST2 (Human) Recombinant Protein