Ver mas grande
BST2 (Human) Recombinant Protein
AB-P8496
Producto nuevo
BST2 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | BST2 |
| Gene Alias | CD317 |
| Gene Description | bone marrow stromal cell antigen 2 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | BST2 protein 0.5mg/mL is supplied in 20mM Tris-HCl, pH-8, 0.1M NaCl, 1mM DTT and 20% Glycerol. |
| Gene ID | 684 |
Más información
Human BST2 (Q10589, 50 a.a. - 161 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.