View larger
Human BST2 (Q10589, 50 a.a. - 161 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichia
AB-P8496
New product
BST2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | BST2 |
| Gene Alias | CD317 |
| Gene Description | bone marrow stromal cell antigen 2 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | BST2 protein 0.5mg/mL is supplied in 20mM Tris-HCl, pH-8, 0.1M NaCl, 1mM DTT and 20% Glycerol. |
| Gene ID | 684 |
More info
Human BST2 (Q10589, 50 a.a. - 161 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.