NPPB (Human) Recombinant Protein
  • NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein

Ref: AB-P8493
50 ug

Información del producto

NPPB (Human) Recombinant Protein
Información adicional
Size 50 ug
Gene Name NPPB
Gene Alias BNP
Gene Description natriuretic peptide precursor B
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a 0.2��m filtered concentrated solution in 20mM Tris-HCl, pH 8.0 and 150mM NaCl.
Gene ID 4879

Enviar un mensaje


NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein