NPPB (Human) Recombinant Protein
  • NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein

Ref: AB-P8493
NPPB (Human) Recombinant Protein

Información del producto

Human NPPB (P16860) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name NPPB
Gene Alias BNP
Gene Description natriuretic peptide precursor B
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a 0.2��m filtered concentrated solution in 20mM Tris-HCl, pH 8.0 and 150mM NaCl.
Gene ID 4879

Enviar un mensaje


NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein