View larger
Human NPPB (P16860) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8493
New product
NPPB (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | NPPB |
| Gene Alias | BNP |
| Gene Description | natriuretic peptide precursor B |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from a 0.2��m filtered concentrated solution in 20mM Tris-HCl, pH 8.0 and 150mM NaCl. |
| Gene ID | 4879 |
More info
Human NPPB (P16860) recombinant protein expressed in Escherichia coli.