NPPB (Human) Recombinant Protein Ver mas grande

NPPB (Human) Recombinant Protein

AB-P8491

Producto nuevo

NPPB (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 10 mg
Gene Name NPPB
Gene Alias BNP
Gene Description natriuretic peptide precursor B
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Form Lyophilized
Antigen species Target species Human
Storage Buffer The protein was lyophilized without additives.
Gene ID 4879

Más información

Human NPPB (P16860) recombinant protein.

Consulta sobre un producto

NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein