NPPB (Human) Recombinant Protein
  • NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein

Ref: AB-P8491
NPPB (Human) Recombinant Protein

Información del producto

Human NPPB (P16860) recombinant protein.
Información adicional
Size 10 mg
Gene Name NPPB
Gene Alias BNP
Gene Description natriuretic peptide precursor B
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Form Lyophilized
Antigen species Target species Human
Storage Buffer The protein was lyophilized without additives.
Gene ID 4879

Enviar uma mensagem


NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein