Ngf (Mouse) Recombinant Protein Ver mas grande

Ngf (Mouse) Recombinant Protein

AB-P8486

Producto nuevo

Ngf (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name Ngf
Gene Alias Ngfb
Gene Description nerve growth factor
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer The Recombinant Mouse b-NGF was lyophilized without additives.
Gene ID 18049

Más información

Mouse Ngf (P01139) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Ngf (Mouse) Recombinant Protein

Ngf (Mouse) Recombinant Protein