Ngf (Mouse) Recombinant Protein
  • Ngf (Mouse) Recombinant Protein

Ngf (Mouse) Recombinant Protein

Ref: AB-P8486
20 ug

Información del producto

Ngf (Mouse) Recombinant Protein
Información adicional
Size 20 ug
Gene Name Ngf
Gene Alias Ngfb
Gene Description nerve growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer The Recombinant Mouse b-NGF was lyophilized without additives.
Gene ID 18049

Enviar uma mensagem


Ngf (Mouse) Recombinant Protein

Ngf (Mouse) Recombinant Protein