Ngf (Mouse) Recombinant Protein
  • Ngf (Mouse) Recombinant Protein

Ngf (Mouse) Recombinant Protein

Ref: AB-P8486
Ngf (Mouse) Recombinant Protein

Información del producto

Mouse Ngf (P01139) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ngf
Gene Alias Ngfb
Gene Description nerve growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer The Recombinant Mouse b-NGF was lyophilized without additives.
Gene ID 18049

Enviar uma mensagem


Ngf (Mouse) Recombinant Protein

Ngf (Mouse) Recombinant Protein