Ver mas grande
BMP8B (Human) Recombinant Protein
AB-P8481
Producto nuevo
BMP8B (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | BMP8B |
| Gene Alias | BMP8|MGC131757|OP2 |
| Gene Description | bone morphogenetic protein 8b |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | BMP8B protein solution (1mg/mL) containing 20mM Tris-HCl buffer (pH8.0), 0.4M Urea and 10% glycerol. |
| Gene ID | 656 |
Más información
Human BMP8B (P34820, 264 a.a. - 402 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.