BMP8B (Human) Recombinant Protein
  • BMP8B (Human) Recombinant Protein

BMP8B (Human) Recombinant Protein

Ref: AB-P8481
20 ug

Información del producto

BMP8B (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name BMP8B
Gene Alias BMP8|MGC131757|OP2
Gene Description bone morphogenetic protein 8b
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH.
Form Liquid
Antigen species Target species Human
Storage Buffer BMP8B protein solution (1mg/mL) containing 20mM Tris-HCl buffer (pH8.0), 0.4M Urea and 10% glycerol.
Gene ID 656

Enviar uma mensagem


BMP8B (Human) Recombinant Protein

BMP8B (Human) Recombinant Protein