BMP7 (Human) Recombinant Protein
  • BMP7 (Human) Recombinant Protein

BMP7 (Human) Recombinant Protein

Ref: AB-P8479
BMP7 (Human) Recombinant Protein

Información del producto

Human BMP7 (P18075) recombinant protein with His-tag at N-terminal expressed in Nicotiana benthamiana expression system.
Información adicional
Size 2 x 10 ug
Gene Name BMP7
Gene Alias OP-1
Gene Description bone morphogenetic protein 7
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Form Lyophilized
Antigen species Target species Human
Storage Buffer BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Gene ID 655

Enviar un mensaje


BMP7 (Human) Recombinant Protein

BMP7 (Human) Recombinant Protein