View larger
Human BMP7 (P18075) recombinant protein with His-tag at N-terminal expressed in Nicotiana benthamiana expression system.
AB-P8479
New product
BMP7 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | BMP7 |
| Gene Alias | OP-1 |
| Gene Description | bone morphogenetic protein 7 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. |
| Gene ID | 655 |
More info
Human BMP7 (P18075) recombinant protein with His-tag at N-terminal expressed in Nicotiana benthamiana expression system.