Ver mas grande
BMP7 (Human) Recombinant Protein
AB-P8478
Producto nuevo
BMP7 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | BMP7 |
| Gene Alias | OP-1 |
| Gene Description | bone morphogenetic protein 7 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH?LEHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | BMP-7 protein (0.5mg/mL) solution contains 10mM sodium citrate pH3.5 and 10% glycerol. |
| Gene ID | 655 |
Más información
Human BMP7 (P18075, 293 a.a. - 431 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in Escherichia coli.