BMP7 (Human) Recombinant Protein
  • BMP7 (Human) Recombinant Protein

BMP7 (Human) Recombinant Protein

Ref: AB-P8478
50 ug

Información del producto

BMP7 (Human) Recombinant Protein
Información adicional
Size 50 ug
Gene Name BMP7
Gene Alias OP-1
Gene Description bone morphogenetic protein 7
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH?LEHHHHHH.
Form Liquid
Antigen species Target species Human
Storage Buffer BMP-7 protein (0.5mg/mL) solution contains 10mM sodium citrate pH3.5 and 10% glycerol.
Gene ID 655

Enviar un mensaje


BMP7 (Human) Recombinant Protein

BMP7 (Human) Recombinant Protein