View larger
Human BMP7 (P18075, 293 a.a. - 431 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in <i>Escherichi
AB-P8478
New product
BMP7 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | BMP7 |
| Gene Alias | OP-1 |
| Gene Description | bone morphogenetic protein 7 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH?LEHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | BMP-7 protein (0.5mg/mL) solution contains 10mM sodium citrate pH3.5 and 10% glycerol. |
| Gene ID | 655 |
More info
Human BMP7 (P18075, 293 a.a. - 431 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in Escherichia coli.