Ver mas grande
BMP6 (Human) Recombinant Protein
AB-P8476
Producto nuevo
BMP6 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | BMP6 |
| Gene Alias | VGR|VGR1 |
| Gene Description | bone morphogenetic protein 6 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | The BMP6 solution (0.25mg/mL) contains 10mM Sodium citrate buffer (pH 3.5) and 10% glycerol. |
| Gene ID | 654 |
Más información
Human BMP6 (P22004, 375 a.a. - 513 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.