BMP6 (Human) Recombinant Protein
  • BMP6 (Human) Recombinant Protein

BMP6 (Human) Recombinant Protein

Ref: AB-P8476
2 x 10 ug

Información del producto

BMP6 (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name BMP6
Gene Alias VGR|VGR1
Gene Description bone morphogenetic protein 6
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH.
Form Liquid
Antigen species Target species Human
Storage Buffer The BMP6 solution (0.25mg/mL) contains 10mM Sodium citrate buffer (pH 3.5) and 10% glycerol.
Gene ID 654

Enviar un mensaje


BMP6 (Human) Recombinant Protein

BMP6 (Human) Recombinant Protein