View larger
Human BMP6 (P22004, 375 a.a. - 513 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi
AB-P8476
New product
BMP6 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | BMP6 |
| Gene Alias | VGR|VGR1 |
| Gene Description | bone morphogenetic protein 6 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | The BMP6 solution (0.25mg/mL) contains 10mM Sodium citrate buffer (pH 3.5) and 10% glycerol. |
| Gene ID | 654 |
More info
Human BMP6 (P22004, 375 a.a. - 513 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.