BDNF (Human) Recombinant Protein
  • BDNF (Human) Recombinant Protein

BDNF (Human) Recombinant Protein

Ref: AB-P8459
BDNF (Human) Recombinant Protein

Información del producto

Human BDNF (P23560, 19 a.a. - 128 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name BDNF
Gene Alias MGC34632
Gene Description brain-derived neurotrophic factor
Storage Conditions Store lyophilized protein at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS.
Gene ID 627

Enviar un mensaje


BDNF (Human) Recombinant Protein

BDNF (Human) Recombinant Protein