BDNF (Human) Recombinant Protein
  • BDNF (Human) Recombinant Protein

BDNF (Human) Recombinant Protein

Ref: AB-P8459
2 x 10 ug

Información del producto

BDNF (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name BDNF
Gene Alias MGC34632
Gene Description brain-derived neurotrophic factor
Storage Conditions Store lyophilized protein at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS.
Gene ID 627

Enviar uma mensagem


BDNF (Human) Recombinant Protein

BDNF (Human) Recombinant Protein