Ver mas grande
BDNF (Human) Recombinant Protein
AB-P8458
Producto nuevo
BDNF (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | BDNF |
| Gene Alias | MGC34632 |
| Gene Description | brain-derived neurotrophic factor |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0) and 10% glycerol. |
| Gene ID | 627 |
Más información
Human BDNF (P23560, 129 a.a. - 247 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.