BDNF (Human) Recombinant Protein
  • BDNF (Human) Recombinant Protein

BDNF (Human) Recombinant Protein

Ref: AB-P8458
BDNF (Human) Recombinant Protein

Información del producto

Human BDNF (P23560, 129 a.a. - 247 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name BDNF
Gene Alias MGC34632
Gene Description brain-derived neurotrophic factor
Storage Conditions Store, frozen at -20C for longer periods of time.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH 8.0) and 10% glycerol.
Gene ID 627

Enviar un mensaje


BDNF (Human) Recombinant Protein

BDNF (Human) Recombinant Protein