BDNF (Human) Recombinant Protein View larger

Human BDNF (P23560, 129 a.a. - 247 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi

AB-P8458

New product

BDNF (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name BDNF
Gene Alias MGC34632
Gene Description brain-derived neurotrophic factor
Storage Conditions Store, frozen at -20ºC for longer periods of time.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH 8.0) and 10% glycerol.
Gene ID 627

More info

Human BDNF (P23560, 129 a.a. - 247 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.

Enviar uma mensagem

Human BDNF (P23560, 129 a.a. - 247 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi

Human BDNF (P23560, 129 a.a. - 247 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi