View larger
Human BDNF (P23560, 129 a.a. - 247 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi
AB-P8458
New product
BDNF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | BDNF |
| Gene Alias | MGC34632 |
| Gene Description | brain-derived neurotrophic factor |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0) and 10% glycerol. |
| Gene ID | 627 |
More info
Human BDNF (P23560, 129 a.a. - 247 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.