Ver mas grande
DEFB103A (Human) Recombinant Protein
AB-P8450
Producto nuevo
DEFB103A (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | DEFB103A |
| Gene Alias | DEFB103|DEFB3|HBD-3|HBD3|HBP-3|HBP3 |
| Gene Description | defensin, beta 103A |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized without additives. |
| Gene ID | 55894 |
Más información
Human DEFB103A (P81534) recombinant protein expressed in Escherichia coli.