DEFB103A (Human) Recombinant Protein
  • DEFB103A (Human) Recombinant Protein

DEFB103A (Human) Recombinant Protein

Ref: AB-P8450
DEFB103A (Human) Recombinant Protein

Información del producto

Human DEFB103A (P81534) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name DEFB103A
Gene Alias DEFB103|DEFB3|HBD-3|HBD3|HBP-3|HBP3
Gene Description defensin, beta 103A
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized without additives.
Gene ID 55894

Enviar uma mensagem


DEFB103A (Human) Recombinant Protein

DEFB103A (Human) Recombinant Protein