CLU (Dog) Recombinant Protein Ver mas grande

CLU (Dog) Recombinant Protein

AB-P8436

Producto nuevo

CLU (Dog) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name CLU
Gene Alias GP80
Gene Description clusterin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MKHHHHHHASDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRIPYH
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Lyophilized from PBS, pH 7.5.
Gene ID 442971

Más información

Dog CLU (P25473, 23 a.a. - 445 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.

Consulta sobre un producto

CLU (Dog) Recombinant Protein

CLU (Dog) Recombinant Protein