CLU (Dog) Recombinant Protein
  • CLU (Dog) Recombinant Protein

CLU (Dog) Recombinant Protein

Ref: AB-P8436
CLU (Dog) Recombinant Protein

Información del producto

Dog CLU (P25473, 23 a.a. - 445 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CLU
Gene Alias GP80
Gene Description clusterin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRIPYH
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Lyophilized from PBS, pH 7.5.
Gene ID 442971

Enviar un mensaje


CLU (Dog) Recombinant Protein

CLU (Dog) Recombinant Protein