CLU (Dog) Recombinant Protein View larger

Dog CLU (P25473, 23 a.a. - 445 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichia c

AB-P8436

New product

CLU (Dog) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name CLU
Gene Alias GP80
Gene Description clusterin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MKHHHHHHASDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRIPYH
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Lyophilized from PBS, pH 7.5.
Gene ID 442971

More info

Dog CLU (P25473, 23 a.a. - 445 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.

Enviar uma mensagem

Dog CLU (P25473, 23 a.a. - 445 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichia c

Dog CLU (P25473, 23 a.a. - 445 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichia c