CLU (Dog) Recombinant Protein
  • CLU (Dog) Recombinant Protein

CLU (Dog) Recombinant Protein

Ref: AB-P8436
2 x 10 ug

Información del producto

CLU (Dog) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name CLU
Gene Alias GP80
Gene Description clusterin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRIPYH
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Lyophilized from PBS, pH 7.5.
Gene ID 442971

Enviar uma mensagem


CLU (Dog) Recombinant Protein

CLU (Dog) Recombinant Protein