Clu (Rat) Recombinant Protein
  • Clu (Rat) Recombinant Protein

Clu (Rat) Recombinant Protein

Ref: AB-P8435
Clu (Rat) Recombinant Protein

Información del producto

Rat Clu (P05371) recombinant protein with T7-tag at N-terminal fusion and His-tag at C-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Clu
Gene Alias APOJ|CLI|RATTRPM2B|SGP-2|SGP2|SP-40|TRPM-2|TRPM2B|Trpm2|Trpmb
Gene Description clusterin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MASMTGGQQMGRDPNSSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFTRASGIIDTLFQDRFFTHEPQDIHHFSPMGFPHKRPHLLYPKSRLVRSLMPLSHYGPLSFHNMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGEDDRTVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQALEHHHHHH.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from 0.02M Tris buffer and 0.05M NaCl, pH 7.5.
Gene ID 24854

Enviar un mensaje


Clu (Rat) Recombinant Protein

Clu (Rat) Recombinant Protein