Clu (Rat) Recombinant Protein
  • Clu (Rat) Recombinant Protein

Clu (Rat) Recombinant Protein

Ref: AB-P8435
2 x 10 ug

Información del producto

Clu (Rat) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name Clu
Gene Alias APOJ|CLI|RATTRPM2B|SGP-2|SGP2|SP-40|TRPM-2|TRPM2B|Trpm2|Trpmb
Gene Description clusterin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MASMTGGQQMGRDPNSSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFTRASGIIDTLFQDRFFTHEPQDIHHFSPMGFPHKRPHLLYPKSRLVRSLMPLSHYGPLSFHNMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGEDDRTVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQALEHHHHHH.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from 0.02M Tris buffer and 0.05M NaCl, pH 7.5.
Gene ID 24854

Enviar uma mensagem


Clu (Rat) Recombinant Protein

Clu (Rat) Recombinant Protein