Ver mas grande
APOE (Human) Recombinant Protein
AB-P8428
Producto nuevo
APOE (Human) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | APOE |
| Gene Alias | AD2|LPG|MGC1571|apoprotein |
| Gene Description | apolipoprotein E |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MHHHHHHKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQ |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 10mM MOPS, 50mM NaCl, 0.2 %( w/v) CHAPS and 1mM TCEP, PH 7.5 |
| Gene ID | 348 |
Más información
Human APOE (P02649, 19 a.a. - 317 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.