APOE (Human) Recombinant Protein
  • APOE (Human) Recombinant Protein

APOE (Human) Recombinant Protein

Ref: AB-P8428
APOE (Human) Recombinant Protein

Información del producto

Human APOE (P02649, 19 a.a. - 317 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name APOE
Gene Alias AD2|LPG|MGC1571|apoprotein
Gene Description apolipoprotein E
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MHHHHHHKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQ
Form Liquid
Antigen species Target species Human
Storage Buffer 10mM MOPS, 50mM NaCl, 0.2 %( w/v) CHAPS and 1mM TCEP, PH 7.5
Gene ID 348

Enviar uma mensagem


APOE (Human) Recombinant Protein

APOE (Human) Recombinant Protein