View larger
Human APOE (P02649, 19 a.a. - 317 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi
AB-P8428
New product
APOE (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | APOE |
| Gene Alias | AD2|LPG|MGC1571|apoprotein |
| Gene Description | apolipoprotein E |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MHHHHHHKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQ |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 10mM MOPS, 50mM NaCl, 0.2 %( w/v) CHAPS and 1mM TCEP, PH 7.5 |
| Gene ID | 348 |
More info
Human APOE (P02649, 19 a.a. - 317 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.