Ver mas grande
APOD (Human) Recombinant Protein
AB-P8426
Producto nuevo
APOD (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | APOD |
| Gene Alias | - |
| Gene Description | apolipoprotein D |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSHHHHHH. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.05M phosphate buffer and 0.075M NaCl, pH 7.4 |
| Gene ID | 347 |
Más información
Human APOD (P05090, 21 a.a. - 189 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.