View larger
Human APOD (P05090, 21 a.a. - 189 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.
AB-P8426
New product
APOD (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | APOD |
| Gene Alias | - |
| Gene Description | apolipoprotein D |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSHHHHHH. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.05M phosphate buffer and 0.075M NaCl, pH 7.4 |
| Gene ID | 347 |
More info
Human APOD (P05090, 21 a.a. - 189 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in HEK293 cells.