APOC1 (Human) Recombinant Protein
  • APOC1 (Human) Recombinant Protein

APOC1 (Human) Recombinant Protein

Ref: AB-P8424
APOC1 (Human) Recombinant Protein

Información del producto

Human APOC1 Human (P02654, 27 a.a. - 83 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name APOC1
Gene Alias -
Gene Description apolipoprotein C-I
Storage Conditions Store, frozen at -20C for longer periods of time.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl and 10% glycerol
Gene ID 341

Enviar un mensaje


APOC1 (Human) Recombinant Protein

APOC1 (Human) Recombinant Protein