View larger
Human APOC1 Human (P02654, 27 a.a. - 83 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Esch
AB-P8424
New product
APOC1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | APOC1 |
| Gene Alias | - |
| Gene Description | apolipoprotein C-I |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl and 10% glycerol |
| Gene ID | 341 |
More info
Human APOC1 Human (P02654, 27 a.a. - 83 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.