Apoa1 (Mouse) Recombinant Protein
  • Apoa1 (Mouse) Recombinant Protein

Apoa1 (Mouse) Recombinant Protein

Ref: AB-P8420
Apoa1 (Mouse) Recombinant Protein

Información del producto

Mouse Apoa1 (Q00623, 25 a.a. - 264 a.a.) partial-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Apoa1
Gene Alias Alp-1|Apoa-1|Brp-14|Ltw-1|Lvtw-1|MGC102525|Sep-1|Sep-2|Sep2
Gene Description apolipoprotein A-I
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDK
Form Liquid
Antigen species Target species Mouse
Storage Buffer Phosphate buffered saline (pH7.4), 20% glycerol and 1mM DTT.
Gene ID 11806

Enviar un mensaje


Apoa1 (Mouse) Recombinant Protein

Apoa1 (Mouse) Recombinant Protein