Apoa1 (Mouse) Recombinant Protein Ver mas grande

Apoa1 (Mouse) Recombinant Protein

AB-P8420

Producto nuevo

Apoa1 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name Apoa1
Gene Alias Alp-1|Apoa-1|Brp-14|Ltw-1|Lvtw-1|MGC102525|Sep-1|Sep-2|Sep2
Gene Description apolipoprotein A-I
Storage Conditions Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDK
Form Liquid
Antigen species Target species Mouse
Storage Buffer Phosphate buffered saline (pH7.4), 20% glycerol and 1mM DTT.
Gene ID 11806

Más información

Mouse Apoa1 (Q00623, 25 a.a. - 264 a.a.) partial-length recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Apoa1 (Mouse) Recombinant Protein

Apoa1 (Mouse) Recombinant Protein