Apoa1 (Mouse) Recombinant Protein View larger

Mouse Apoa1 (Q00623, 25 a.a. - 264 a.a.) partial-length recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8420

New product

Apoa1 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name Apoa1
Gene Alias Alp-1|Apoa-1|Brp-14|Ltw-1|Lvtw-1|MGC102525|Sep-1|Sep-2|Sep2
Gene Description apolipoprotein A-I
Storage Conditions Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDK
Form Liquid
Antigen species Target species Mouse
Storage Buffer Phosphate buffered saline (pH7.4), 20% glycerol and 1mM DTT.
Gene ID 11806

More info

Mouse Apoa1 (Q00623, 25 a.a. - 264 a.a.) partial-length recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Apoa1 (Q00623, 25 a.a. - 264 a.a.) partial-length recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Apoa1 (Q00623, 25 a.a. - 264 a.a.) partial-length recombinant protein expressed in <i>Escherichia coli</i>.