APOA1 (Human) Recombinant Protein Ver mas grande

APOA1 (Human) Recombinant Protein

AB-P8417

Producto nuevo

APOA1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Gene Name APOA1
Gene Alias MGC117399
Gene Description apolipoprotein A-I
Storage Conditions Upon reconstitution should be stored at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 335

Más información

Human APOA1 (P02647) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

APOA1 (Human) Recombinant Protein

APOA1 (Human) Recombinant Protein