APOA1 (Human) Recombinant Protein
  • APOA1 (Human) Recombinant Protein

APOA1 (Human) Recombinant Protein

Ref: AB-P8417
APOA1 (Human) Recombinant Protein

Información del producto

Human APOA1 (P02647) recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name APOA1
Gene Alias MGC117399
Gene Description apolipoprotein A-I
Storage Conditions Upon reconstitution should be stored at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 335

Enviar uma mensagem


APOA1 (Human) Recombinant Protein

APOA1 (Human) Recombinant Protein