Ver mas grande
Adipoq (Mouse) Recombinant Protein, Globular
AB-P8398
Producto nuevo
Adipoq (Mouse) Recombinant Protein, Globular
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | Adipoq |
| Gene Alias | 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1 |
| Gene Description | adiponectin, C1Q and collagen domain containing |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN. |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | 20mM Tris-HCl pH7.5, 50mM NaCl, 5mM DTT and 10% Glycerol. |
| Gene ID | 11450 |
Más información
Mouse Adipoq (Q60994, 111 a.a. - 247 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.