Adipoq (Mouse) Recombinant Protein, Globular
  • Adipoq (Mouse) Recombinant Protein, Globular

Adipoq (Mouse) Recombinant Protein, Globular

Ref: AB-P8398
Adipoq (Mouse) Recombinant Protein, Globular

Información del producto

Mouse Adipoq (Q60994, 111 a.a. - 247 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Adipoq
Gene Alias 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN.
Form Liquid
Antigen species Target species Mouse
Storage Buffer 20mM Tris-HCl pH7.5, 50mM NaCl, 5mM DTT and 10% Glycerol.
Gene ID 11450

Enviar uma mensagem


Adipoq (Mouse) Recombinant Protein, Globular

Adipoq (Mouse) Recombinant Protein, Globular